PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G1492
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 258aa    MW: 29292.4 Da    PI: 7.9514
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G1492genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.27.1e-174592148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+++Ed++l+d+++ +G g+W++ ++  g++R++k+c++rw +yl
      Gh_A11G1492 45 KGAWSKQEDQKLIDYIRIHGEGCWRSLPKAAGLHRCGKSCRLRWINYL 92
                     79********************************************97 PP

2Myb_DNA-binding51.13.2e-1698142147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++ ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++
      Gh_A11G1492  98 RGNFAQDEEDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSH 142
                      89999*****************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.7E-243695IPR009057Homeodomain-like
PROSITE profilePS5129417.8074092IPR017930Myb domain
SuperFamilySSF466891.61E-2842139IPR009057Homeodomain-like
SMARTSM007172.8E-144494IPR001005SANT/Myb domain
PfamPF002494.2E-154592IPR001005SANT/Myb domain
CDDcd001671.76E-114792No hitNo description
PROSITE profilePS5129426.33193147IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2596147IPR009057Homeodomain-like
SMARTSM007173.7E-1597145IPR001005SANT/Myb domain
PfamPF002491.5E-1498142IPR001005SANT/Myb domain
CDDcd001676.28E-11100143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MCFPLPPSSY FLSPCLVAQK VRESFTFDFE TPMRKPCCDK QGTNKGAWSK QEDQKLIDYI  60
RIHGEGCWRS LPKAAGLHRC GKSCRLRWIN YLRPDIKRGN FAQDEEDLII KLHALLGNRW  120
SLIAGRLPGR TDNEVKNYWN SHIKRKLMKM GIDPNNHKLN QYPHHVGPLN PTTTNSMDVA  180
CKLRVCSTDN DDGISDAASY LEDATPPTGI SNLDLDLTIA FPSSPIKNII EESQQKTASI  240
VTNDEEEQYT VPTLLLFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-29451477108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.166240.0boll| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0341340.0AF034134.1 Gossypium hirsutum MYB-like DNA-binding domain protein (MYB6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012491251.10.0PREDICTED: transcription repressor MYB6-like
SwissprotQ388517e-77MYB6_ARATH; Transcription repressor MYB6
TrEMBLA0A0D2QUZ70.0A0A0D2QUZ7_G
STRINGVIT_14s0006g01620.t011e-102(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.15e-78myb domain protein 6